| Description | Recombinant streptococcal protein G lacking the albumin binding region thereby avoiding undesirable reactions with albumin, though the Fc binding domain is still present. The recombinant Protein G is produced in Escherichia coli using sequence from Streptococcus C1-C2-C3. The Protein G contains amino acids 190-384 having a molecular mass of 21.6 kDa. The Protein-G migrates on SDS-PAGE around 32 kDa. |
| Amino Acid Sequence | MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE |
| Specificity | 1. Binds with greater affinity to most mammalian immunoglobulins than Protein A, including human IgG3 and rat IgG2a.
2. Does not bind to human IgM, IgD and IgA. |
| Formulation and Reconstitute | Lyophilized with no additives. Can be reconstitution with deionized water or PBS. After reconstitution, aliquot and store at -20°C. Avoid repeated freeze/thaw cycles. |
| Stability | 2 years at -20°C |
| Applications | Protein G binds to the constant region of many species of immunoglobulin G. It can be used to detect, quantify and purify IgG antibodies and antibody/antigen complexes. Recombinant Protein G contains only IgG binding domains. The albumin-binding domain as well as cell wall and cell membrane binding domains have been removed to ensure the maximum specific IgG binding capacity. |
