Description:
Transcription Factor IIF, Rap30 subunit (Cat# P1009)
| Species |
Human |
| Expression Host |
E. coli |
| Tag |
His-tag |
| Purity |
90% |
| Molecular Weight |
28.3 kDa. |
| Gene Accession Number |
NM_004128. |
View Full Specifications |
|
| Description | The transcription factor IIF (TFIIF) is composed of 58 kDa (RAP74) and 26 kDa (RAP30) subunits as a heterodimer, and was first identified through the ability to interact with immobilized RNA polymerase II (1, 2). The RAP30 subunit of TFIIF contains two distinct regions with sequence similarity to E coli factors and can deliver RNA polymerase II to the promoter to support transcription initiation in the absence of RAP74 (2, 3).
The His tagged recombinant RAP30 protein is isolated from an E. coli strain that carries the coding sequence of human RAP30 under the control of a T7 promoter.
RAP30 can interact with RNA polymerase II, with TFIIB, and with DNA (3-5). Molecular weight is calculated by protein sequence of full length Rap30. SDS_PAGE migration is around 30 kDa. | | Target Gene Sequence | MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLR IAKTQGRTEVSFTLNEDLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSSD KLSLEGIVVQRAECRPAASENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQ YNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILK EIGVQNVKGIHKNTWELKPEYRHYQGEEKSD | | Synonym | BTF4; RAP30; TF2F2; TFIIF | | Storage and Formulation | Protein is stored in 20 mM Tris-Cl (pH 8.0), 20% Glycerol, 100 mM KCl, 1 mM DTT and 0.2 mM EDTA buffer and kept at -800C. Avoid repeated freeze thaw cycles. | | Application | 1 unit equals 1 nanogram of purified protein. 1 – 10 units are sufficient for a gel mobility shift assay in a 20µl reaction; 20 units are sufficient for a reconstituted transcription assay and 100 units are sufficient for a protein-protein interaction assay. For research use only. | | Reference | 1. Sopta, M. et al., (1985) J. Biol. Chem. 260, 10353-10360
2. Sopta, M. et al., (1989) Nature 341, 410-414
3. McCracken, S. et al., (1991) Science 253, 900-902
4. Ha, I. Et al., (1993) Genes & Dev. 7, 1021-1032
5. Tan, S. et al., (1994) Proc. Natl. Acad. Sci. USA 92, 6042-6046 | | Image of SDS-PAGE /Western-blot |  |
|
