Sign in or Register
Transcription Factor IIE, p34 subunit
1 unit equals 1 nanogram of purified protein. 20 units are sufficient for an in vitro reconstituted transcription assay in the presence of 34-kDa subunit; 100 units are sufficient for a protein-protein interaction assay. variable in different lots. For research use only.
Protein is stored in 20 mM Tris-Cl (pH 8.0), 20% Glycerol, 100 mM KCl, 1 mM DTT and 0.2 mM EDTA buffer and kept at -800c. Avoid repeted freeze thaw cycles.
GTF2E1; FE; TF2E1; TFIIE-A
MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVE HGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEI LDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYNVRDKKALLRLLDQHDQ RGLGGILLEDIEEALPNSQKAVKALGDQILFVNRPDKKKILFFNDKSCQFSVDEEFQK LWRSVTVDSMDEEKIEEYLKRQGISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEH LAGVLKDYSDITSSK
The human Transcription Factor IIE (TFIIE) is composed of 56 kDa (α) and 34 kDa (β) subunits and is shown to be a heterotetramer (1, 2).
TFIIE binds to RNA polymerase II in solution and joins the preinitiation complex probably concomitant with RNA polymerase II and TFIIF (3).
The His tagged recombinant protein is purified from an E. coli strain that contains the coding sequence of human TFIIE β subunit under the control of T7 promoter (5).
Both subunits are required to reconstitute the functional transcription factor IIE.
1. Ohkuma, Y. et al., (1990) Proc. Natl. Acad. Sci. USA 87, 9163-9167
2. Inostroza, J. et al., (1991) J. Biol. Chem. 266, 9304-9308
3. Flores, O. et al., (1990) J. Biol. Chem. 265, 5629-5634
4. Maldonado, E. et al., (1996) Methods Enzymol. 274, 72-100
5. Lin et al., (2005) Nuc Acids Res. 33:3072 - 3081
This products is recommended For RESEARCH USE ONLY and is Not qualified for Use in Diagnostic or Therapeutic Procedures.
All Rights Reserved | Protein One LLC.